Recombinant Mouse IL-25 protein(N-His)(active) Sizes: 20μg, 100μg Catalogue Numbers: PKSM041471-20, PKSM041471-100 Citations, Manuals and MSDS Available upon request. Abbreviation: IL-25 Target Symptom: EDF; BCDFII; TRF Target Species: Mouse Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: Q8VHH8 Accession: Q8VHH8 Background: Interleukin-25 (IL-25) is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. IL-25 is a member of the IL-17 family of cytokines. However, unlike the other members of this family, IL-25 promotes T helper (Th) 2 responses. IL-25 also regulates the development of autoimmune inflammation mediated by IL-17– producing T cells. IL-25 and IL-17, being members of the same cytokine family, play opposing roles in the pathogenesis of organ-specific autoimmunity. IL-25 promotes cell expansion and Th2 cytokine production when Th2 central memory cells are stimulated with thymic stromal lymphopoietin (TSLP)– activated dendritic cells (DCs), homeostatic cytokines, or T cell receptor for antigen triggering. Elevated expression of IL-25 and IL-25R transcripts was observed in asthmatic lung tissues and atopic dermatitis skin lesions, linking their possible roles with exacerbated allergic disorders. A plausible explanation that IL-25 produced by innate effector eosinophils and basophils may augment the allergic inflammation by enhancing the maintenance and functions of adaptive Th2 memory cells had been provided. Activity: Measured by its ability to induce CXCL1 secretion in HT‑29 cells. The ED50 for this effect is < 1 ng/mL. Sequence: MYQAVAFLAMIVGTHTVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 20.04 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only