Recombinant Human TGF alpha protein(N-His)(active) Size: 100μg Catalogue Number: PKSH034146-100 Citations, Manuals and MSDS Available upon request. Abbreviation: TGF alpha Target Symptom: Sarcoma growth factor; TGF-type I; ETGF Target Species: Human Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: P01135 Accession: P01135 Background: TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar. Activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 10⁶IU/mg. Sequence: MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 17.83 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only