Recombinant Human IL-11 protein(N-His)(active) - PKSH034102Recombinant Human IL 11 protein(N His)(active) Size: 100g Catalogue Number: PKSH034102 100 Citations, Manuals and MSDS Available upon request. Abbreviation: IL 11 Target Symptom: AGIF (Adipogenesis Inhibitory Factor) Target Species: Human Expression Host: E. coli Application: Cell culture Fusion Tag: N His UNIProt ID: P20809 Accession: P20809 Background: Interleukin 11 (IL 11) is a member of a family of human growth factors that includes human growth
Shopping security
Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols
product description
Why choose thelockerguy wholesale?
Recombinant Human IL-11 protein(N-His)(active)
Size: 100μg
Catalogue Number: PKSH034102-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: IL-11
Target Symptom: AGIF (Adipogenesis Inhibitory Factor)
Target Species: Human
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P20809
Accession: P20809
Background: Interleukin 11 (IL-11) is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors. IL-11 is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. It also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2, It activates a signaling cascade that promotes cell proliferation. The signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.
Activity: Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant human IL-11 is approximately > 1 x 107IU/ mg.
Sequence: MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 8.0
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 22.26 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
Show More
Recombinant Human IL-11 protein(N-His)(active) - PKSH034102