20% OFF shipping at neumaticosmexico.com on orders over $79 + up to 10% OFF products
neumaticosmexico.com
home > Recombinant Human IL-11 protein(N-His)(active) - PKSH034102 > Recombinant Human IL-11 protein(N-His)(active) - PKSH034102
download picture
Recombinant Human IL-11 protein(N-His)(active) - PKSH034102Recombinant Human IL 11 protein(N His)(active) Size: 100g Catalogue Number: PKSH034102 100 Citations, Manuals and MSDS Available upon request. Abbreviation: IL 11 Target Symptom: AGIF (Adipogenesis Inhibitory Factor) Target Species: Human Expression Host: E. coli Application: Cell culture Fusion Tag: N His UNIProt ID: P20809 Accession: P20809 Background: Interleukin 11 (IL 11) is a member of a family of human growth factors that includes human growth
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols
Recombinant Human IL-11 protein(N-His)(active) Size: 100μg Catalogue Number: PKSH034102-100 Citations, Manuals and MSDS Available upon request. Abbreviation: IL-11 Target Symptom: AGIF (Adipogenesis Inhibitory Factor) Target Species: Human Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: P20809 Accession: P20809 Background: Interleukin 11 (IL-11) is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors. IL-11 is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. It also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2, It activates a signaling cascade that promotes cell proliferation. The signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. Activity: Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant human IL-11 is approximately > 1 x 107IU/ mg. Sequence: MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 22.26 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only

Recombinant Human IL-11 protein(N-His)(active) - PKSH034102

Item no : 39477419578
sold recently : Login >>
US$ 517.30
Pay in 4 interest-free payments of $129.32 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 11 - Jul 16

Enjoy 20% off shipping

US$ 517.30

1-11

US$ 465.57

12-35

US$ 362.11

36-59

US$ 310.38

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Orb - Birth
Orb - Birth

US$ 19.98

Min. order: 1 piece

4.1 (96 reviews)

Sold : Login>>

Related Searches