Shopping security
Recombinant Human Galectin-14 protein(N-His)
Size: 100μg
Catalogue Number: PKSH034189-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: Galectin-14
Target Symptom: LGALS14; CLC2; PPL13
Target Species: Human
Expression Host: E.coli
Fusion Tag: N-His
UNIProt ID: Q8TCE9
Accession: Q8TCE9
Background: Galectin-14 is a member of the Galectin family of carbohydrate binding proteins. The members of Galectin family contain one or two carbohydrate recognition domains, which can bind β-Galactoside. LGALS14 is expressed intracellularly in placenta and eosinophils, and is released by eosinophils following allergen stimulation. LGALS14 may be involved in the development of allergic inflammation. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 16.92 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
Ships within 48 hours · Estimated delivery Jul 11 - Jul 16
US$40
Get nowSign up to your membership to get coupons up to
15%
Get nowOpportunity to enjoy order discount up to 15% off
Top-Converting Item to Boost Your Average Order