20% OFF shipping at neumaticosmexico.com on orders over $79 + up to 10% OFF products
neumaticosmexico.com
home > Recombinant Human Galectin-14 protein(N-His) - PKSH034189 > Recombinant Human Galectin-14 protein(N-His) - PKSH034189
download picture
Recombinant Human Galectin-14 protein(N-His) - PKSH034189Recombinant Human Galectin 14 protein(N His) Size: 100g Catalogue Number: PKSH034189 100 Citations, Manuals and MSDS Available upon request. Abbreviation: Galectin 14 Target Symptom: LGALS14; CLC2; PPL13 Target Species: Human Expression Host: E. coli Fusion Tag: N His UNIProt ID: Q8TCE9 Accession: Q8TCE9 Background: Galectin 14 is a member of the Galectin family of carbohydrate binding proteins. The members of Galectin family contain one or two
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

Recombinant Human Galectin-14 protein(N-His)

Size: 100μg

Catalogue Number: PKSH034189-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: Galectin-14

Target Symptom: LGALS14; CLC2; PPL13

Target Species: Human

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: Q8TCE9

Accession: Q8TCE9

Background: Galectin-14 is a member of the Galectin family of carbohydrate binding proteins. The members of Galectin family contain one or two carbohydrate recognition domains, which can bind β-Galactoside. LGALS14 is expressed intracellularly in placenta and eosinophils, and is released by eosinophils following allergen stimulation. LGALS14 may be involved in the development of allergic inflammation. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.

Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 16.92 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

Recombinant Human Galectin-14 protein(N-His) - PKSH034189

Item no : 29471920942
sold recently : Login >>
US$ 517.30
Pay in 4 interest-free payments of $129.32 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 11 - Jul 16

Enjoy 20% off shipping

US$ 517.30

1-11

US$ 465.57

12-35

US$ 362.11

36-59

US$ 310.38

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

LA-8042TB
LA-8042TB

US$ 209.50

Min. order: 1 piece

4.1 (277 reviews)

Sold : Login>>

FX-3725-1P
FX-3725-1P

US$ 119.50

Min. order: 1 piece

4.8 (101 reviews)

Sold : Login>>

Related Searches